you're reading...
Dunia Pendidikan



1.  Konsep Manajemen Perubahan


MenurutTimCreacev,DirektorofResearchand Development ProsciResearch(2011)manajemen perubahan diartikan sebagai berikut,“Changemanagement:theprocess,toolsand techniquesto managethepeople-sideofchange to   achieve   a   required  business  outcome.

Perubahan kurikulum 2013, perlu!


Manajemenperubahanadalahsuatuproses, alatdanteknikuntuk mengelolaorangoranguntukberubahdalamrangkamencapaitujuanbisnis yangtelahditentukan.Tujuanutamadari perubahanituadalahuntuk meningkatkankinerja organisasidengancaramengubahbagaimanacara mengerjakan pekerjaan yanglebihbaik.Wikipedia  (2012)  menyatakan  bahwa,  Changemanagementis  an approachtoshifting/transitioning individuals, teams,and organizationsfroma


current statetoadesired futurestate“.Manajemenperubahanadalahsuatu pendekatan  untuk  mengubah  individu,  tim  dan  organisasi  dari  keadaan sekarang  menuju  keadaan  masa  depan.  Selanjutnya  dalam  EnglishCollins Dictionary,dinyatakanbahwa“Changemanagementisasystematicapproach todealingwithchange,bothfromtheperspectiveofanorganization andonthe individuallevel(EnglishCollinsDictionary)”.Manajemen  perubahaadalah pendekatan yangsistematisyangberkenaandengan perubahan,baikdari perspektif individumaupun organisasi. Berdasarkan  beberapa  definisi  tersebut,  dapat  dikemukakan  bahwa, manajemen  perubahan  adalah  suatu  pendekatan,  alat,  teknik  dan  proses pengelolaansumberdayauntukmembawaorganisasidarikeadaansekarang menujukeadaanbaruyangdiinginkan,agarkinerjaorganisasimenjadilebih baik.Dalamorganisasi,perubahanitumeliputiindividu,tim,organisasi,struktur, proses,polapikirdanbudayakerja


ahwa manajemen   perubaha adalah   proses   pengelolaan sumberdayauntukmembawakeadaansekarang   ini menujukeadaanbaru  yangdiharapkan.Kalau dikaitkan denganorganisasi sekolah,maka dapat dinyatakan bahwa,manajemen perubahan sekolah adalah proses pengelolaansumber dayasekolah untukmembawa keadaan  sekolah  sekarang,  sekolah  dengankurikulum 2006  menuju  keadaan  sekolah  yang  diinginkan  yaitu sekolah dengankurikulum tahun 2013. Kepalasekolah menghadapitantanganperubahan penerapan   kurikulu 2013 Kesiapan   yan perlu dicermatiadalahmengenalielemenperubahandengan sikap terbuka, meningkatkan pengetahuan dan keterampilan agar dapatmengelola perubahan sehingga menjadisekolah yangadaptif terhadapperubahan Menjadikepalasekolahprofesionalmemerlukandayaadaptasiterhadap perubahandenganmenjadikepalasekolah pembelajar,sehinggamemandang perubahankurikulumsebagaisesuatuyangseharusnya.Alasannyajelas,karena ilmupengetahuan,teknologi,dantantanganhidup terusberubah, maka kebutuha sisw pun   teru berubah   menyesuaikan   dengan   kebutuhan jamannya.Lebihdariitu,pengalamankitabekerjamembuktikanbahwaapa yangdihasilkan terdahuluselalumemerlukanperbaikan,sehinggaperubahan merupakan keharusan.Tugaskepalasekolah  padakonteksiniamatstrategis.KepalaSekolah menjadipenentuutama keberhasilansekolahnya.Tugasmemimpinperubahan adaditangannya.Selainsebagaipendidik,pengajar,pelatih,pembimbing,ia jugaberperansebagaipemimpin pembelajaran,manajerperubahan,dan pengembangbudaya sekolah. Dalam  menyongsong  pelaksanaan  perubahan,  kepala  sekolah  perlu belajardaripengalamanmenerapkankurikulum2006.Pengalaman dapat menunjukka fakt keberhasila maupun   kegagalan Berangkat   dari pengalamandirisendiri, maupunbelajardaripengalamanrekansejawat,kepala sekolahdapatmerancangrencanatindakan yangakan diperankannyadalam menerapkankurikulum 2013.E.Mulyasa(2013)perubahanperubahanyang perlu dicermatioleh kepala sekolah dalam implemnetasi kurikulum 2013 adalah sebagai berikut:

a.  Kerangka Dasar  danStruktur Kurikulum

b.  Pedoman ImplementasiKurikulum 2013

c.  Pedoman Pengelolaan Kurikulum 2013

d.  Pedoman Evaluasi Kurikulum

e.  Standar KompetensiLulusan

f Kompetensi IntidanKompetensi Dasar

g.  Buku Guru

h.  Buku Siswa

i.   Silabus danRPP

j.   Standar ProsesdanModel Pembelajaran

k.  Standar Penilaian

l.   Pedoman penilaian danRapor

m.Buku PedomanBimbingan dan Konseling


Karenaitu,mengenalidataatau fakta tentangkeberhasilanatauketidak berhasilansebelumnya  merupakaninputyangberhargadalamdalam pelatihan ini.  Daya  analisisnya  dikuatkan  dengan  kemampuan  menggunakan  teori sehinggadapatmemilahdatayangsudahsesuaidenganyangtidaksesuai dalam menunjangpembelajaran yangefektif.Pada   gambar   2.2   dapat   dikemukakan   bahwa sebelu proses pengelolaansumber dayadilakukan,makaterlebihduludiketahuikeadaan sekarang  (existingcondition)secara  lengkap,  akurat  dan  obyektif.  Setelah kondisisekarang ditetapkan,makaselanjutnya ditentukanarahkondisiyang diinginkan jugaditetapkan.Dengan mengetahuisecara pastikondisisekarang dankondisiyangakan datang,makakegiatanpengelolaansumberdaya (manajemen) untukmencapai tujuan perubahandapatdilakukan.



Gambar 2.2.  Ruanglingkup manajemen perubahan.


Manajemenperubahanseringdisebutdengan manajementransisidan manajemeninovasi.Dikatakan manajementransisi,karenamengelolakeadaan yangbersifattransisi darikondisilamamenujukondisibaru.Dikatakan manajemeninovasi,karenatujuandariperubahanadalahuntuk pembaharuan, dari yanglamake yangbaru supaya lebihbaik


Perbedaan  utamaantara  manajemen  perubahan  dengan  manajemen yangkonvensional/biasa adalah terletakpada adanyafaktorfaktor kuatyang menghambatperubahan.Faktorfaktor penghambattersebutperludikelolaagar berubahmenjadifaktor pendorong perubahan.Karenaadanyahambatan,maka kemungkinanperjalanandalammencapaitujuanperubahanditunjukkan pada gambar2.3.Berdasarkangambar2.3terlihatbahwa,pencapaianperubahan yangefektifditunjukkandalamlintasan1.Lintasan1merupakangarislurus, garisyangterpendekuntukmencapaivisiperubahan.Lintasan 2,3,dan4, adalah suatulintasan untukmencapaivisiyangtidakefisien,karena harus berbelokbelokbarumencapaitujuan.Lintasan5,adalahsuatu contoh manajemen perubahan yangtidakmencapai sasaran.Setiap  perubahan,  baikfisik  maupunsosial  dan  budaya  berada  pada kontekshambatandandayadorong.Padagambardiatasmenunjukkan bahwa setiap  terjadi  perubahan  (bergerak  atau  direm  mendadak)  badan  akan melakukanperlawa        nan.


Berdasarkantingkatkedalamanperubahan danmetodenya,jenis perubahan meliputiperubahan rutin,darurat,mutu, radikal,dankondisimakro:


a.  Perubahan rutin hampirselalu dihadapisetiaphari

b.  Perubahan  darurat  yaitu  perubahan  yang  sangat  mendadak  dan  tidak terduga sebelumnya
c.  Perubahandalamhalmutuyaituperubahanyangterjaditentangmutu produk
d.  Perubahan  radikal  yaitu  perubahan  sistem  manajemen  atau  struktur organisasi karena adanya perundang-undanganbaru.
e.  Perubahankondisimakroyaituperubahankondisiperekonomian,politikdan keamanan,  kodisi lingkungan.
Manajemenperubahanseringdiartikan sebagaimanajementransisidan transformasi.Katatransformasiberasaldarikatatotransform,yangbermakna mentransformasikan  atau  mengubah  sesuatu  menjadi  bentuk  lain  yang berbeda,misalnyamengubahstrukturorganisasi sekolah,kultursekolah,tugas– tugas,teknologi,danperilakuwargasekolah(Manning&Curtis, 2003).Oleh karenaitumodel kepemimpinanyangsesuaiadalahkepemimpinan transformasional.


Kepemimpinan transformasional ialah kepemimpinan yangmemilikivisi jauh  ke  depan  dan  mampu  mengidentifikasi  perubahan  lingkungan  serta mampumentransformasiperubahantersebutke dalamorganisasi;memelopori perubahan  dan  memberikan  motivasi  dan  inpsirasi  kepada  individuindividukaryawanuntukkreatifdaninovatif,sertamembangunteam workyangsolid; membawapembaharuandalametoskerja dankinerjamanajemen;beranidan bertanggung  jawamemimpin  dan  mengendalikan  organisasi  (Bass,1985). Esensikepemimpinantransformasionaladalahsharing ofpowerdengan melibatkanbawahansecarabersamasamauntukmelakukan perubahan.Dalam merumuskan perubahanbiasanyadigunakan pendekatantransformasionalyang manusiawi diman lingkungan   kerja   yan partisipatif   dengan   model manajemenyangkolegialpenuhketerbukaandankebersamaan dalam mengambil   keputusan Dengan   demikian   kepemimpina transformasional adalahkepemimpinanyangmampumenciptakanperubahanyangmendasar dan dilandasioleh nilai-nilaiagama,sistem danbudayauntukmenciptakan inovasidankreativitas pengikutnyadalamrangkamencapaivisiyangtelah ditetapkan.


Dalammenyikapiperubahandiperlukanagenperubahan(agent of change),yaitu  individu  atau  kelompok  yang  terlibat  dalam  merencanakan perubahan   dan   mengimplementasikannya.   Agen   perubahan   terdir atas pimpinanorganisasi(sebuahkeharusan)dan pegawaipegawaiyangdipilih” berdasarkankriteria tertentu.Adapunperanagenperubahanadalahsebagai berikut:


a.  Katalisadalah peran kepala sekolah sebagaipemimpin untukmeyakinkan pendidikdan tenaga kependidikan dimasing-masingsekolah yang dipimpinnyabahwaperubahanyangdilakukan akanmembuatsekolah menjadilebih baik.


b.  Pemberi  Solusi  adalahperankepalasekolahsebagaipemimpindapat memberi  jalan  keluauntuk  pemecahan  masalah  yang  dialami  warga sekolah dalam melakukan perubahan.


c.  Mediatoradalah peran kepalasekolah sebagai pemimpinuntukmembantu melancarkanproses perubahan.


d.  Penghubun Sumber   Daya   adalah  peran  kepala  sekolah  sebagai pemimpin untukmenghubungkan pegawaiyangada didalam satu sekolah.


2.  RuangLingkup Perubahan

 Pelaksanaan perubahan kurikulum 2006 menjadiKurikulum 2013. BerdasarkanPPNomor32Tahun2013,fokusutamaperubahankurikulum 2013 meliputiempatStandarNasionalPendidikan,yaitu:(1)Standar Kompetensi Lulusan,(2)StandarIsi, (3)StandarProses, dan(4)StandarPenilaian. Ruang lingkupperubahanterdapatpadairisan keempatstandar sepertiterlihatpada diagram berikut:



Adapun pergeseran darikurikulum2006 kekurikulum2013 dapat digambarkandalam matrikdibawah ini.



a.   Pergeseran dalamStandar KompetensiLulusan (SKL)







Elemen Perubahan


·    SKL,

·    SK,

·    KD,dan

·    Indikator  Pencapaian



·    SKL

·    Kompetensi Inti(KI)

·    Kompetensi Dasar

Kompetensi intimeliputi:

KI-  Kompetensi   inti   sikap spiritual .

KI-2:  Kompetensi intisosial.

KI-3:              Kompetensi       inti pengetahuan

KI-3:              Kompetensi       inti keterampilan

2. Lebih     menitik     beratkan     pada pengembangan kompetensidimensi kognitif.

Menunjukkan perilaku yang mencerminkansikap orangberiman, berahla mulia,   percaya  diri,  dan

bertanggung         jawab         dalam

berinteraksisecara efektif dengan lingkungan

Memiliki    kemampuan    pikir    serta tindakyangefektif dankreatif.

Memiliki       pengetahuan      faktual, konseptual,   dan   prosedura yang

berwawasan                 kemanusiaan, lingkungan,                    kebangsaan,


Pembelajaran mengembangkan kemampuamenguasai  fakta, konsep,prosedur,metakognitif.

·   SD:menguasai faktadankonsep

·   SMP:  menguasai  fakta,  konsep, danprosedur.









Elemen Perubahan


·SMA/SMK:    menguasai    fakta, konsep,  prosedur,  dan metakognitif.

3.   SKL    pada    tiap    mata    pelajaran dikembangkan secaralepas

SKLdikembangkan menjadi kompetensiintisebagai pengikatdan acuan         bagi         pengembangan

kompetensi dasar.




b.  Pergeseran dalam Standar Isi





Elemen Perubahan

1. Kurikulummasihbelumoptimal memberikankepada pesertadidik untuk  mempelajari  permasalahan dilingkungan masyarakatnyadan mengaplikasikannya dalam kehidupansehari-hari.

Kurikulumholistikdan integratifyang berfokuspada alam,sosial,dan budaya

2. Pembelajara tematik   di   SD diberikanhanyadikelasI,IIdan III  saja.

Pendekatan   pembelajara tematik terpadu padasemua jenjangkelas.

3. Dalampembelajaransiswapada umumnya hanya menerima apa yangdiberikan gurusaja,sehingga daya    inisiatif    dan    kreativitas berkarya yangtidakoptimal.

Pembelajaran menggunakan pendekatan  saintifik,  sehingga memilikiperilaku khasyangberkaitan dengankebutuhan siswapada hidupnya,meliputi;


Domain  sikap:  menerima, mejalankan,   menghargai, menghayati,danmengamalkan.


Domainpengetahuan: mengingat, memahami, menerapkan, Menganalisis,mengevaluasi


Domainketerampilan: mengamati, menanya,  mencoba,  menalar, menyaji, dan mencipta.

4.  Jumlah  mata  pelajaran  untuk  SD

sebanyak 10 matapelajaran

5.  Jumlah  mata  pelajaran  SMP  12 mata pelajaran

Jumlahmatapelajaran dikurangi,tetapi jambelajaruntuk setiapmata pelajaran maupun keseluruhan ditambah.


Jumlahmata  pelajarandiSD kelas1s.d kelas 3 adalah 6 mata pelajaran,kelas 4 s.dkelas 6adalah  8mata pelajaran.


JumlahmatapelajarandiSMP adalah10 mata pelajaran










Elemen Perubahan

6.  JambelajardiSD untuk kelasI,II, III masingmasing26,27,dan 28 jam,danuntuk kelasIV,V danVI masing-masing32 JamPelajaran, dengancatatan bolehnambah masing-masing4 jam/minggu

Jambelajar diSD untukkelasI,II,III masingmasing30,32, dan34jam,dan untukkelasIV,V danVIadalah36Jam Pelajaran

7.  Pembelajara di   kela masingmasingberdiri sendiri(parsial)

Khusuuntuk  mata  pelajaraIPA  dan IPS,   di   SMP   pembelajara terpadu denganmenggunakan tema

8.  TIK  merupakan  salah  satu  mata pelajaran.

TIK menjadimedia semua mata pelajaran di SMP



c.  Pergeseran dalam Standar Proses






Elemen Perubahan

1.  Pembelajaranberpusatpadaguru.

Guru      ceramah      dan      siswa mendengar   dan   menyimak,   dan


Pembelajaran berpusatpadasiswa. Memperhatikansiswa berinteraksi, beragumen,  berdebat,dan berkolaborasi.Guru Sebagai fasilitator.

2.  Pembelajaran    satu    arah,    guru mengajari siswa.

Pembelajaran   interkatif   (multi   arah), siswa dengan guru,siswa dengan siswa, siswa denganobjekpembelajaran.

3.  Pembelajara menerapka model isolasi,sebelumnyasiswabertanya

kepada  guru  dan  berguru  pada

buku  yang  ada  di  dalam  kelas semata

Pembelajaran dalam konteks  jejaring.


Siswamenimbailmu dari berbagai sumber;dari siapa saja, darimanasaja, dariinternet, dariperpustakaansekolah, darihasil praktikdiluar dan didalam kelas.

4. Pembelajarandisampaikansecara verbaldan abstrak.Contoh-contoh diberikan    guru    yang    artifisial

(buatan  atau  bukan  diangkat  dari

fakta yangsesungguhnya).

Pembelajaran  menggunakan  contoh yangdiperoleh darianalisisbacaan,dari kenyataanpadakehidupan  sehari-hari

hasil   pengamatan   dan   pengalaman

belajar siswa.

5.  pembelajaran       mengembangkan kapasitastiap individu.

Pembelajaranberbasis tim.Guru mengembangkan kapasitas belajar individ melalu kerja   sam dalam



Belajar   merupakan   prose interaksi sosialdengansesamasiswayangsaling









Elemen Perubahan


mengasah,salingmembantu untuk meraih keberhasilan kelompok   dan keberhasilan individu.

6.  Proses pembelajaran menstimulasi indra lihatdandengar.

Pembelajaran menstimulasiseluruh panca indra,komponen jasmanidan rohani  terlibat  aktif  dalam  kegiatan


7.  Proses pembelajaran merujukpada referensi yangdipilihguru

Pembelajaranmerujukpadabukuguru danbuku siswayangtelah ditetapkan.

8.  Pembelajaran bahasa Indonesia disetarakan denganmata pelajaran


Pembelajaran       bahasa       Indonesia berbasis  teks  dan  menjadi  penghela

mata pelajaran lainnya.




d.  Pergeseran dalam Standar Penilaian







1.  Penilaiandilakukanberorientasipada hasil,

Penilaianotentikmulai prosessampai hasilmencakuptiga aspek,yaitusikap, pengetahuan dan keterampilan.


Pendekatan penilaianyangdigunakan adalah Penilaian Acuan Kriteria (PAK)


Penilaiansikap meliputi:observasi, penilaian diri,penilaian antarpeserta didikdanjurnal


Penilaianpengetahuanmeliputi: Tes tertulis, teslisandanpenugasan.


Penilaianketerampilanmeliputi :tes praktik,projekdanportofolio.




3.  Tujuan Perubahan


Tujua manajemem perubahanadalahmengupayakanagar proses transformasiberlangsung

dalamwaktuyang relatifcepatdengankesulitan– kesulitan  yang  seminimal  mungkin,
 bersikap  positif  terhadap  perubahan

(mengurangi   resistensi),   meningkatnya   daya   inisiatif   dala melakukan perubahan,meningkatnya motivasi,berinsiatif denganharapanyangtinggi.


 Dengandemikian,jika manajemenperubahaninidikeloladenganbaik, yaitudirencanakandenganmatang,dilaksanakansesuaiprogram, serta dievaluasi,  maka  akansangat  bermanfaat  bagi  sekolah  dan  seluruh  warga sekolah,sertabagiwarga masyarakatsebagai pengguna pendidikan.



Manfaatperubahan  diantaranya adalah sebagai berikut:

a.  Sekolahmampuberadaptasidenganperubahan dalamlingkunganinternal maupun eksternaluntukpembangunanberkelanjutandanmenjadikan sekolah yangefektif.
b.  Sekolahmampuberprestasidandapatmeningkatkankemampuangurudanpeserta didikuntukmencapai tujuan.
c.  Dapatmenjagaiklimdisekolahmenjadilebihterbukadanjujur   warga sekolah sekolah merasapuas dan bangga.
d.  Pola   pemeliharaa dapa mempertahankan   loyalitas   dan   membua seseorangmenjadi kebanggaan disekolah mereka sendiri.Ini merupakan tradisi  yang  baik  untuk  membuat  seseorang  ingin  menjadi  orang  yang terbaik.




4.  StrategiMencapaiPerubahan


Pelaksanaanmanajemenperubahandapatdilakukan  denganberbagaiteknik/strategiseperti berikut:


a.  PendidikandanKomunikasi.

1)  Teknik/strategiyangdiberikandenganmemberikanpenjelasansecara tuntas tentanglatar belakang,tujuan,dan akibat adanya perubahan.
2)  Mengomunikasikanberbagaiperubahandalambebagai   bentuk   dan kesempatan,inidigunakan bilaadakekuranganatauketidaktepatan informasi  dananalisis
b.  Partisipasi.
Teknikyangdigunakan denganmengajaksemuapihakuntukmengambil keputusan.Pimpinanhanyabertindaksebagaifasilitatordanmotivator.Hal inidigunakanbila inisiatortidakmempunyaiinformasiygdibutuhkanuntuk merancangperubahandan sedangkanoranglainnyamempunyaikekuasaan untukmenolak
c.  Memberikan kemudahandandukungan.
Jikapegawaitakutatau cemas,lakukankonsultasiataubahkan terapi.Beri keterampilanygmempermudah  dan mendukungprosesperubahan. Taktik inidigunakan bilapenolakanberkembangsebagaihasilketidakmampuan ad


d.  Negosiasi   danpersetujuan


Membanguninisiatif perubahandenganbersediamenyesuaikanperubahan dengankebutuhan dan kepentinganpara penolakaktifatau potensial.Cara inibiasadilakukanjika yangmenentangmempunyaikekuatanyangcukup besar.

e.  Manipulasi dan Kooptasi.


Manipulasiadalahmenutupikondisi ygsesungguh-nya.Misalnyamemelintir (twisting)faktaagartampaklebihmenarik,tidakmengutarakan halyang negatif,dsb..Kooptasi dilakukandengancaramemberikankedudukan pentingkepada   pimpinan penentangperubahan dalam mengambil keputusan.Teknikinidigunakanbilataktiklaintidakakanberhasilatau mahal

f Paksaan.


1)  Berikanancamandanjatuhkanhukumanbagisiapapunyangmenentang dilakukannya perubahan.

2)  Bila  kecepatan  adalah  esensial,  dan  inisiator  perubahan  mempunyai kekuasaan cukup besar.

3)  Mengelola Perubahan Sekolah


Terdapatbeberapamodelmanajemen perubahan yangberisilangkah– langkahdalam melakukanperubahanorganisasi,termasukorganisasi sekolah sebagaiberikut.  Modelyangakandikemukan,adalahmodelKurt Lewin(Bapak manajemen perubahan);Mike Green;ADKAR;Julian Randall.



a.  Model KurtLewin.


Kurt  Lewin  dalam  Chung  and  Megginson  (1990)  mengemukakan  langkah– langkahdalam pengembanganorganisasi ditunjukkanpada gambar 2.10 berikut. Manajeme perubaha organisasi   yan dikemukakan   ole Kurt   Lewin menggunakankonsepilmufisikadanteknik,di manasuatubendamisalnyabesi, bilaakandirubahbentuknya,makaharusdicairkan(unfreezing)terlebihdulu agar  mudah  dibentuk.  Setelah  benda  yang  akan  dibentuk  dicairkan  maka, selanjutnyadimasukkandalamcetakansehinggadiharapkandiperoleh  bentuk baru  seperti  yang  diinginkan.  Setelah  besi  cair  dimasukkan  dalam  cetakan (change),makaselanjutnyadidinginkan(refreezing)sehinggaakandiperoleh bentukbaruyangpermanen.



Langkahlangkah ManajemenPerubahan Organisasi, menuurtKurtLewin



LangkahlangkahmanajemenperubahanyangdikemukakanolehKurtLewin(1990) adalah sebagai berikut.


1)  Pada  tahappertamadinamakantahap  pencairan.  Padatahap  iniyang dilakukanpimpinanadalahmenjelaskantentangartipentingnya perubahan, memperkuatdoronganuntuk berubah,danmengurangihambatan perubah

Terkait   dengan   manajeme perubaha sekolah karen terjadinya
perubahandarikurikulum2006menujukurikulum2013,makapadatahap inikepalasekolah perlumenjelaskan tentangpentingnyaperubahandari kurikulum   2006   menuju   kurikulum   2013 mencari   dan   memperkuat dukunganuntuk berubah,danmengurangihambatandanmemperkecil adanyapenolakanterhadapperubahan  darikurikulum2006kekurikulum 2013
2)  Pada  tahap  kedua  dinamakan  tahap  mengubah.  Pada  tahap  ini  yang dilakukan  adalah  mengubah  IndividualComponen,GrouComponents StructuralComponent.Komponen individu,kelompokdanstruktur.
3)    Pada  tahap  ketiga  tahap  pembekuan  atau  tahap  pemeliharaan  agar perubahanyangterjadi bisalebihpermanen.Padatahapiniyangdilakukan adalah,reinforcingthenewlylearndbehavior(memberidorongankepada perilakubaru)finding“fit”betweenorganizational components (penyesuaikan  antar  komponen  organisasi),  maintaining“fits”  between organizational components,memeliharaantarkomponenorganisasiyang telah ses
b.  Model ADKAR
Proci,pengembanganmanajemenperubahanyangsederhana   disingkat denganADKAR,merupakansingkatandariAwareness,Desire,Knowledge, Ability,Reinforcement.
1Kesadaran:pimpinanmeningkatkankesadaranparaanggotanyatentang pentingnya dan rencanaperubahan yangakandilakukan.
2Harapan,pimpinanmengajakdanmendorongparaanggotanyaagarmau mendukungdanmelaksanakan perubahan


3)  Ilmpengetahuan,paraanggotaorganisasiditingkatkanpengetahuan agar memilikibekaluntukmelaksanakan perubahan yangtelah ditentukan


4) Keterampilan,meningkatkankemampuanparaanggotaagardapat mengimplementasikan perubahan yangtelah ditetapkan.


5)  Penguatan,pimpinan memberikandorongandanmotivasikepadaseluruh anggotaorganisasisecaraterusmenerusagarhasilperubahanyang telah dicapai dapat  dijaga dandipertahankan.

Perubahanyangtelah dilaksanakanharus dikontrol,agarrencana perubahan yangtelah

ditetapkan dapatdilaksanakan danhasilnyatercapai.Hussey(2000) menyatakanterdapat


palingtidak10(sepuluh)penyebab  kegagalandalam melaksanakan perubahansebagai



1)  Implementasi memerlukan waktu lebih lamadariyangdiperkirakan


2)  Banyakmasalah yangtidakteridentifikasisebelumnya


3)  Aktivitasperubahan tidakcukupterorganisir

4)  Aktivitasdan krisis bersaingmemecahkan perhatian sehingga keputusan dan rencana tidak dilaksanakan sebagimana mestinya


5)  Manajer kurangmemilikikapabilitasuntukmelakukan perubahan


6)  Instruksi danpelatihan yangdiberikankepada subordinattidak cuku

7) Faktoreksternalyangtidakterkendaliberdampakserius  terhadap implementasi perubahan


8)  Manajerunitkerjatidak cukupdalammemberikanarahandanlemahdalam kepemimpinan


9)  Tugas pokokimplementasi tidakterdefinisikan secararinci.


10)Sisteminformasiyangtersedia tidakcukupuntukmemonitorimplementasi




5.  Penjaminan Proses dan HasilPerubahan


Padadasarnyapenjaminanprosesdanhasil perubahanmerupakan rangkaiandarikegiatanmanajemenperubahan.Kegiatan inidilakukan dalam rangkamemastikanbahwaprosesperubahanberjalansesuaidenganprogramyangtelahditetapkan.Adapunbentukdaripenjaminanprosesdan hasil perubahaninibisaberupakegiatanmonitoring/pengawasandan evaluasi keterlaksanaan programperubahaan yangtelah ditentukan.Lebih   lanjut,   dala rangka   melaksanakan   kegiatan   penjaminan tersebutdiataskepala sekolahperlumembentuktimmonitoringdanevaluasi yangberanggotakansekurangkurangnyaempatorangberasaldari unsur pendidik,perwakilanKomiteSekolahdan PengawasSekolahsebagaipembina teknis.Untukmemenuhikelengkapan pelaksanaan kegiatan inikepala sekolah perlumemimpintimuntukmenyusuninstrumentmonitoringdan evaluasi programperubahan. Berikutinicontohformatinstrumentmonitoring/evaluasi programperubahan sekolah.





Nama sekolah               :

Kecamatan                    :
Kota /Kabupaten:


Hari/ Tgl














Pelaksanaa n     proses


an dengan pendekatan saintifik

Pendidik     di kelas


pelaksana kurikulum


Seluru proses pembelajarandi

kelas     sasaran

pelaksana kurikulum  2013 dilaksanakan dengan pendekatan saintifik    sesuai karakteristik materi pembajaran

Baru     sekitar

30  %    kelas sasaran kurikulum

2013 melaksanakan


pembelajaran menggunakan pendekatan saintifik

Pendidik      di kelassasaraan


mampusecara optimal  untuk melaksakan kegiatan pembelajaran dengan pendekatan pembelajaran saintifik


Pelaksanaanpembelajaransaintifikdikelassasaranbelumterlaksanasesuaitarget.yang diprogramkan.

Perluadanyapenguatanbagipendidikdikelassasaranagarlebihmemahamidanmampu melaksanakankegiatanpembelajarandenganpendekatansaintifik.


Mengetahui Pengawas Pembina….,…2014


Pelaksana Monitoring/Evaluasi


                            Keterangan:  *)Coretyangtidakperlu

Pengawasan/monitoringinidilakukanuntuk mengetahuitingkat pelaksanaan  rencana  perubahan  sesuai  program  dan  tujuan.  Sedangkan evaluasidilakukanuntukmengetahuiketercapaianprogramdantujuanyang

telahdilaksankan.Denganadanyapengawasandanevaluasiini,akan dapat diketahuihambatan, dankelemahandalammelaksanakanperubahan. Berdasarkankelamahandan hambatan tersebut,selanjutnyadianalisisuntuk mencarisebabsebabtimbulnyahambatan.Berdasarkan sebab-sebabtersebut selanjutnya ditentukantindak lanjutuntukmengatasinya.




6.  Aktivitas Pembelajaran


Aktivitas  pembelajaran  dikembangkan  dengan  pendekatan  saintifik, modelpembelajaranberbasisaktivitas(lesson learning),pembelajaranberbasis tugas(learningbasedproject).Langkah kegiatan pembelajarandilakukan pada beberapa langkah berikut:


1.  Membaca,mendengar,menyimak,melihatbahanajarmateriManajemePerubahan

 2.  Menyusun  beberapapertanyaantentanginformasiyangtidak dipahamidari apayangdiamatiataupertanyaanuntukmendapatkaninformasi tambahan tentangapayangdiamati


3. Mengumpulkanbeberapainformasidenganmengamativideotentang pelaksanaan  manajemen  perubahan.  Mengumpulkan     beberapa  fakta tentangperubahan yangharus dilakukanuntuk mencapai tujuan.


4.  Mengolah  informasi  yang  sudah  dikumpulkan  baik  terbatas  dari  hasil kegiatan   mengumpulkan/eksperimen   mau   pun   hasil   dar kegiatan mengamatidankegiatan mengumpulkan informasi dari tayanganvideo.


5.  Menyampaikan  hasil  pengamatan,  kesimpulan  berdasarkan  hasil  analisis secaralisan,tertulis, atau media lainnya



7.  Penilaian

Penilaian Otentikdenganinstrumentpengamatan
1.  Sikap


a.  Kedisiplinan        :hadirtepatwaktu,menyelesaikan tugastepatwaktu

b.  Kerjasama          :memilikitanggungjawabuntukmenyelesaikantugasdenganbaik
c.  Tanggungjawab:Mampubekerjasamadalam menyelesaikantugasdan bersamasama mencari solusiterhadappermasalahan yangdihadapi kelompok



2.  Pengetahuan


Tes Tulis:  PredanPosttes


3.  Keterampilan


a.  Keterampilan berpikir

b.  Keterampilan reak
c.  Keterampilan interaktif
d.  Ketersmpilan kontibusi dalam kelompok
e.  Keterampilan memimpin




D Rangkuman


Manajemen perubahanadalah prosespengelolaan sumber daya untuk membawakeadaansekarangmenujukeadaanbaruyangdiharapkan, sesuai dengankurikulum tahun2013.Berdasarkantingkatkedalamanperubahan  danmetodenyamakajenisperubahan yangdihadapimeliputiperubahan rutin,darurat,muturadikaldan kondisimakro.

Keberhasilan  mengembangkan  budaya  sekolah  ditentukan  denganefektivitaskomunikasidan interaksikepalasekolah dengan pemangku kepentingansehinggamembangkitkankepatuhan,disiplin,dan motif berpartisipasi untukmewujudkan keunggulan.Denganadanyakurikulum2013,makaperubahanyangutamaadalahmerubah model kepemimpinan darimodel konvensional,berubah menjadi kepemimpinan perubahan.Kepala sekolah harusmenjadiagen perubahan di sekolah,mampu merubah pola pikir pendidikdantenaga kependidikan yangada disekolahyangdipimpinnya,memberimotivasisehinggamenjadidaya dorong untukmelaksanakanperubahan.Sebagaipimpinan,kepalasekolahjuga harus berperansebagaimanajeryangberfungsimengelolaperubahan melalui pelaksnakanfungsifungsimanajemensekolah dalamrangka perubahan sekolah
Dengan  perubahan  kurikulum  sekolah  dari  kurikulum  2006  menjadi kurikulum2013makaelemenperubahandikelasyang  inti  adalahproses pembelajaran.Pada kurikulum sebelumnya proses pembelajaran menekankan padagurumemberitahumakaprosespembelajaranberubahmenjadi model pembelajaran “siswa mencari tahu.
Prosespelatihanmenggunakanpendekatansaintifikdanmetodeaction learning danlearning basedproject.Metodeactionlearning (belajarberbasis karya)untukmembangundanmengimplementasikanideinovatif dalam pengembangankeunggulansekolahberdasarkanfaktaempiris. Metode pembelajaran berbasis proyekuntukmenghasilkan rancangan model penerapan manajemen perubahan.



E Refleksi


Setelahkegiatanpembelajaran,Bapak/Ibudapatmelakukanrefleksi denganmenjawabpertanyaan berikutini:

1.  Apa  yang  Bapak/Ibu  pahami  setelah  mempelajari  materi  manajemen perubahan ?2.  Pengalaman  penting  apa  yang  Bapak/Ibu  peroleh  setelah  mempelajarimateri manajemen perubahan?

3.  Apa  manfaat  materi  manajemen  perubahan  terhadap  tugas  Bapak/Ibu sebagai kepala sekolah?

4.  Apa rencana tindak lanjutBapak/Ibu lakukansetelahkegiatan pelatihan?

5.  Untuk  mencapai  mutu  lulusan  yang  unggul,  perubahan  apa  yang  akan dilakukanolehBapak/Ibu?

1Pusat PengembanganTenagaKependidikan







website: http://bpsdmpk.kemdikbud.go.id/pusbangtendik

email: tendik@kemdikbud.go.id




About suaidinmath

Mohon kontribusi untuk menambal retak dan menambah langkah kesempurnaan tulisan ini ...


Belum ada komentar.

Tinggalkan Balasan, sampaikan gagasan Anda di ruang komentar ini...

Isikan data di bawah atau klik salah satu ikon untuk log in:

Logo WordPress.com

You are commenting using your WordPress.com account. Logout / Ubah )

Gambar Twitter

You are commenting using your Twitter account. Logout / Ubah )

Foto Facebook

You are commenting using your Facebook account. Logout / Ubah )

Foto Google+

You are commenting using your Google+ account. Logout / Ubah )

Connecting to %s

Hari ini

Februari 2014
« Jan   Mar »

Statistik Blog

  • 1,823,159 hit

Arsip blog

Award Blog Pendidikan 2012

Masukkan alamat email Anda untuk berlangganan blog ini dan menerima pemberitahuan tulisan-tulisan baru melalui email.

Bergabunglah dengan 263 pengikut lainnya

Dunia Pendidikan


RSS Republika online

  • The Second Round of Jakarta Election 20 Februari 2017
    By: S Riyanta *) REPUBLIKA.CO.ID, If there’s no extraordinary event and without preceding the official election results from the KPU Jakarta, then based on the results of the quick count survey...
    Agung Vazza
  • NASA Berencana Kirim Lagi Astronot ke Bulan 20 Februari 2017
    REPUBLIKA.CO.ID, WASHINGTON -- Pesawat kargo SpaceX yang disebut Dragon sedang dalam perjalanan menuju Stasiun Luar Angkasa Internasional setelah diluncurkan akhir pekan lalu di Florida. Dalam peluncuran pesawat ruang angkasa...
    Agus Yulianto

RSS educatinalwithptk


NewsAlloy button


suara Edukasi





Live Streaming AM 1251 kHz

Silahkan unduh produk audio radio Suara edukasi



PTK The Frontiers Of New Technology




Siapapun Anda, jika nyasar ke sini semoga tak menyesal 😋🐝🌸


ALL ABOUT CHEMIS_3 (sharing for carring)

Dinas Dikpora Kab. Dompu

Ikhlas Mendidik Untuk Martabat Bangsa dan Negara

Vox Populi

Vox Populi: A Public Sphere for Politics and Poetry

Architecture Here and There

Style Wars: classicsm vs. modernism

Stories From the Belly

A Blog About the Female Body and Its Appetites


"Words - so innocent and powerless as they are, as standing in a dictionary, how potent for good and evil they become in the hands of one who knows how to combine them." ~Nathaniel Hawthorne


Championing a young, diverse, and inclusive America with a unique mix of smart and irreverent original reporting, lifestyle, and comedic content.



rachel eats

stories, pictures and cooking tales from an english woman living in rome.


what it comes down to

tangerine drawings

scribbles and recipes from a pastry chef in paris

Extra Dry Martini

Straight up, with a twist.

Gravity and Levity

A blog about the big ideas in physics, plus a few other things

%d blogger menyukai ini: